IRF2BP1
  • IRF2BP1

Anti-IRF2BP1 Antibody 100ul

Ref: AN-HPA042164-100ul
Anti-IRF2BP1

Información del producto

Polyclonal Antibody against Human IRF2BP1, Gene description: interferon regulatory factor 2 binding protein 1, Alternative Gene Names: DKFZP434M154, IRF-2BP1, Validated applications: IHC, WB, Uniprot ID: Q8IU81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IRF2BP1
Gene Description interferon regulatory factor 2 binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQL
Immunogen LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434M154, IRF-2BP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IU81
HTS Code 3002150000
Gene ID 26145
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IRF2BP1 Antibody 100ul

Anti-IRF2BP1 Antibody 100ul