LRRC37A,KIAA0563
  • LRRC37A,KIAA0563

Anti-LRRC37A Antibody 100ul

Ref: AN-HPA042121-100ul
Anti-LRRC37A

Información del producto

Polyclonal Antibody against Human LRRC37A, Gene description: leucine rich repeat containing 37A, Alternative Gene Names: KIAA0563, Validated applications: IHC, Uniprot ID: A6NMS7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRRC37A
Gene Description leucine rich repeat containing 37A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS
Immunogen EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0563
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NMS7
HTS Code 3002150000
Gene ID 9884
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRRC37A Antibody 100ul

Anti-LRRC37A Antibody 100ul