CCL23,Ckb-8,CKb8
  • CCL23,Ckb-8,CKb8

Anti-CCL23 Antibody 25ul

Ref: AN-HPA042015-25ul
Anti-CCL23

Información del producto

Polyclonal Antibody against Human CCL23, Gene description: chemokine (C-C motif) ligand 23, Alternative Gene Names: Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23, Validated applications: IHC, Uniprot ID: P55773, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCL23
Gene Description chemokine (C-C motif) ligand 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
Immunogen NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55773
HTS Code 3002150000
Gene ID 6368
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCL23 Antibody 25ul

Anti-CCL23 Antibody 25ul