EIF3G,eIF3-delta
  • EIF3G,eIF3-delta

Anti-EIF3G Antibody 25ul

Ref: AN-HPA041997-25ul
Anti-EIF3G

Información del producto

Polyclonal Antibody against Human EIF3G, Gene description: eukaryotic translation initiation factor 3, subunit G, Alternative Gene Names: eIF3-delta, eIF3-p44, eIF3g, EIF3S4, Validated applications: ICC, IHC, WB, Uniprot ID: O75821, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF3G
Gene Description eukaryotic translation initiation factor 3, subunit G
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN
Immunogen ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF3-delta, eIF3-p44, eIF3g, EIF3S4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75821
HTS Code 3002150000
Gene ID 8666
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF3G Antibody 25ul

Anti-EIF3G Antibody 25ul