TP53TG5,C20orf10
  • TP53TG5,C20orf10

Anti-TP53TG5 Antibody 25ul

Ref: AN-HPA041979-25ul
Anti-TP53TG5

Información del producto

Polyclonal Antibody against Human TP53TG5, Gene description: TP53 target 5, Alternative Gene Names: C20orf10, CLG01, dJ453C12.5, Validated applications: IHC, Uniprot ID: Q9Y2B4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TP53TG5
Gene Description TP53 target 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQNNEEFQEIGCSEKELKSKKL
Immunogen SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQNNEEFQEIGCSEKELKSKKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf10, CLG01, dJ453C12.5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2B4
HTS Code 3002150000
Gene ID 27296
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TP53TG5 Antibody 25ul

Anti-TP53TG5 Antibody 25ul