ZNF598,FLJ00086
  • ZNF598,FLJ00086

Anti-ZNF598 Antibody 25ul

Ref: AN-HPA041896-25ul
Anti-ZNF598

Información del producto

Polyclonal Antibody against Human ZNF598, Gene description: zinc finger protein 598, Alternative Gene Names: FLJ00086, Validated applications: ICC, IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF598
Gene Description zinc finger protein 598
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF
Immunogen TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00086
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 90850
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF598 Antibody 25ul

Anti-ZNF598 Antibody 25ul