MVB12A,FAM125A
  • MVB12A,FAM125A

Anti-MVB12A Antibody 100ul

Ref: AN-HPA041885-100ul
Anti-MVB12A

Información del producto

Polyclonal Antibody against Human MVB12A, Gene description: multivesicular body subunit 12A, Alternative Gene Names: FAM125A, FLJ32495, Validated applications: ICC, IHC, WB, Uniprot ID: Q96EY5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MVB12A
Gene Description multivesicular body subunit 12A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL
Immunogen LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM125A, FLJ32495
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EY5
HTS Code 3002150000
Gene ID 93343
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MVB12A Antibody 100ul

Anti-MVB12A Antibody 100ul