MYDGF,C19orf10
  • MYDGF,C19orf10

Anti-MYDGF Antibody 100ul

Ref: AN-HPA041872-100ul
Anti-MYDGF

Información del producto

Polyclonal Antibody against Human MYDGF, Gene description: myeloid-derived growth factor, Alternative Gene Names: C19orf10, IL-25, IL-27, IL25, IL27, IL27w, R33729_1, SF20, Validated applications: IHC, Uniprot ID: Q969H8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MYDGF
Gene Description myeloid-derived growth factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY
Immunogen VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf10, IL-25, IL-27, IL25, IL27, IL27w, R33729_1, SF20
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969H8
HTS Code 3002150000
Gene ID 56005
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MYDGF Antibody 100ul

Anti-MYDGF Antibody 100ul