EXOSC9,p5,p6
  • EXOSC9,p5,p6

Anti-EXOSC9 Antibody 25ul

Ref: AN-HPA041838-25ul
Anti-EXOSC9

Información del producto

Polyclonal Antibody against Human EXOSC9, Gene description: exosome component 9, Alternative Gene Names: p5, p6, PM/Scl-75, PMSCL1, RRP45, Rrp45p, Validated applications: ICC, IHC, Uniprot ID: Q06265, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EXOSC9
Gene Description exosome component 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFA
Immunogen CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p5, p6, PM/Scl-75, PMSCL1, RRP45, Rrp45p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06265
HTS Code 3002150000
Gene ID 5393
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EXOSC9 Antibody 25ul

Anti-EXOSC9 Antibody 25ul