DIS3L,DIS3L1
  • DIS3L,DIS3L1

Anti-DIS3L Antibody 100ul

Ref: AN-HPA041805-100ul
Anti-DIS3L

Información del producto

Polyclonal Antibody against Human DIS3L, Gene description: DIS3 like exosome 3'-5' exoribonuclease, Alternative Gene Names: DIS3L1, FLJ38088, KIAA1955, MGC4562, Validated applications: ICC, IHC, Uniprot ID: Q8TF46, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DIS3L
Gene Description DIS3 like exosome 3'-5' exoribonuclease
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
Immunogen LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DIS3L1, FLJ38088, KIAA1955, MGC4562
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TF46
HTS Code 3002150000
Gene ID 115752
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DIS3L Antibody 100ul

Anti-DIS3L Antibody 100ul