TTC31,FLJ12788
  • TTC31,FLJ12788

Anti-TTC31 Antibody 25ul

Ref: AN-HPA041783-25ul
Anti-TTC31

Información del producto

Polyclonal Antibody against Human TTC31, Gene description: tetratricopeptide repeat domain 31, Alternative Gene Names: FLJ12788, Validated applications: ICC, IHC, WB, Uniprot ID: Q49AM3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TTC31
Gene Description tetratricopeptide repeat domain 31
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GEEDIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSA
Immunogen GEEDIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12788
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q49AM3
HTS Code 3002150000
Gene ID 64427
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC31 Antibody 25ul

Anti-TTC31 Antibody 25ul