RBBP6,P2P-R,PACT
  • RBBP6,P2P-R,PACT

Anti-RBBP6 Antibody 100ul

Ref: AN-HPA041725-100ul
Anti-RBBP6

Información del producto

Polyclonal Antibody against Human RBBP6, Gene description: retinoblastoma binding protein 6, Alternative Gene Names: P2P-R, PACT, SNAMA, Validated applications: ICC, IHC, Uniprot ID: Q7Z6E9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBBP6
Gene Description retinoblastoma binding protein 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD
Immunogen KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names P2P-R, PACT, SNAMA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z6E9
HTS Code 3002150000
Gene ID 5930
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBBP6 Antibody 100ul

Anti-RBBP6 Antibody 100ul