ARMC6,MGC19595
  • ARMC6,MGC19595

Anti-ARMC6 Antibody 25ul

Ref: AN-HPA041681-25ul
Anti-ARMC6

Información del producto

Polyclonal Antibody against Human ARMC6, Gene description: armadillo repeat containing 6, Alternative Gene Names: MGC19595, Validated applications: ICC, IHC, WB, Uniprot ID: Q6NXE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARMC6
Gene Description armadillo repeat containing 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence ATKAFLDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVR
Immunogen ATKAFLDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC19595
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NXE6
HTS Code 3002150000
Gene ID 93436
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARMC6 Antibody 25ul

Anti-ARMC6 Antibody 25ul