GREB1L,C18orf6
  • GREB1L,C18orf6

Anti-GREB1L Antibody 25ul

Ref: AN-HPA041647-25ul
Anti-GREB1L

Información del producto

Polyclonal Antibody against Human GREB1L, Gene description: growth regulation by estrogen in breast cancer-like, Alternative Gene Names: C18orf6, FLJ13687, KIAA1772, Validated applications: IHC, Uniprot ID: Q9C091, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GREB1L
Gene Description growth regulation by estrogen in breast cancer-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT
Immunogen DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C18orf6, FLJ13687, KIAA1772
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C091
HTS Code 3002150000
Gene ID 80000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GREB1L Antibody 25ul

Anti-GREB1L Antibody 25ul