COPE,epsilon-COP
  • COPE,epsilon-COP

Anti-COPE Antibody 25ul

Ref: AN-HPA041605-25ul
Anti-COPE

Información del producto

Polyclonal Antibody against Human COPE, Gene description: coatomer protein complex, subunit epsilon, Alternative Gene Names: epsilon-COP, Validated applications: ICC, IHC, Uniprot ID: O14579, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name COPE
Gene Description coatomer protein complex, subunit epsilon
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNL
Immunogen DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names epsilon-COP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14579
HTS Code 3002150000
Gene ID 11316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COPE Antibody 25ul

Anti-COPE Antibody 25ul