SLC5A2,SGLT2
  • SLC5A2,SGLT2

Anti-SLC5A2 Antibody 100ul

Ref: AN-HPA041603-100ul
Anti-SLC5A2

Información del producto

Polyclonal Antibody against Human SLC5A2, Gene description: solute carrier family 5 (sodium/glucose cotransporter), member 2, Alternative Gene Names: SGLT2, Validated applications: IHC, Uniprot ID: P31639, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC5A2
Gene Description solute carrier family 5 (sodium/glucose cotransporter), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Immunogen FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SGLT2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31639
HTS Code 3002150000
Gene ID 6524
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC5A2 Antibody 100ul

Anti-SLC5A2 Antibody 100ul