CD2BP2,LIN1,PPP1R59
  • CD2BP2,LIN1,PPP1R59

Anti-CD2BP2 Antibody 100ul

Ref: AN-HPA041508-100ul
Anti-CD2BP2

Información del producto

Polyclonal Antibody against Human CD2BP2, Gene description: CD2 (cytoplasmic tail) binding protein 2, Alternative Gene Names: LIN1, PPP1R59, Snu40, Validated applications: ICC, IHC, WB, Uniprot ID: O95400, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD2BP2
Gene Description CD2 (cytoplasmic tail) binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
Immunogen LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LIN1, PPP1R59, Snu40
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95400
HTS Code 3002150000
Gene ID 10421
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD2BP2 Antibody 100ul

Anti-CD2BP2 Antibody 100ul