RIC8A,synembryn
  • RIC8A,synembryn

Anti-RIC8A Antibody 100ul

Ref: AN-HPA041491-100ul
Anti-RIC8A

Información del producto

Polyclonal Antibody against Human RIC8A, Gene description: RIC8 guanine nucleotide exchange factor A, Alternative Gene Names: synembryn, synembryn-A, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NPQ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RIC8A
Gene Description RIC8 guanine nucleotide exchange factor A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TGEEDVIMEALRSYNQEHSQSFTFDDAQQEDRKRLAELLVSVLEQGLPPSHRVIWLQSVRILSRDRNCLDPFTSRQSLQALACYADISVSEGSVPESADMDVVLES
Immunogen TGEEDVIMEALRSYNQEHSQSFTFDDAQQEDRKRLAELLVSVLEQGLPPSHRVIWLQSVRILSRDRNCLDPFTSRQSLQALACYADISVSEGSVPESADMDVVLES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names synembryn, synembryn-A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPQ8
HTS Code 3002150000
Gene ID 60626
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RIC8A Antibody 100ul

Anti-RIC8A Antibody 100ul