ENKD1,C16orf48
  • ENKD1,C16orf48

Anti-ENKD1 Antibody 25ul

Ref: AN-HPA041478-25ul
Anti-ENKD1

Información del producto

Polyclonal Antibody against Human ENKD1, Gene description: enkurin domain containing 1, Alternative Gene Names: C16orf48, DKFZP434A1319, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H0I2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ENKD1
Gene Description enkurin domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Immunogen QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf48, DKFZP434A1319
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0I2
HTS Code 3002150000
Gene ID 84080
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ENKD1 Antibody 25ul

Anti-ENKD1 Antibody 25ul