DNAJC5G,CSP-gamma
  • DNAJC5G,CSP-gamma

Anti-DNAJC5G Antibody 100ul

Ref: AN-HPA041445-100ul
Anti-DNAJC5G

Información del producto

Polyclonal Antibody against Human DNAJC5G, Gene description: DnaJ (Hsp40) homolog, subfamily C, member 5 gamma, Alternative Gene Names: CSP-gamma, FLJ40417, Validated applications: IHC, WB, Uniprot ID: Q8N7S2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DNAJC5G
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
Immunogen NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSP-gamma, FLJ40417
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7S2
HTS Code 3002150000
Gene ID 285126
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAJC5G Antibody 100ul

Anti-DNAJC5G Antibody 100ul