THAP11,CTG-B43a
  • THAP11,CTG-B43a

Anti-THAP11 Antibody 25ul

Ref: AN-HPA041434-25ul
Anti-THAP11

Información del producto

Polyclonal Antibody against Human THAP11, Gene description: THAP domain containing 11, Alternative Gene Names: CTG-B43a, CTG-B45d, HRIHFB2206, Validated applications: IHC, Uniprot ID: Q96EK4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name THAP11
Gene Description THAP domain containing 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRL
Immunogen QLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CTG-B43a, CTG-B45d, HRIHFB2206
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EK4
HTS Code 3002150000
Gene ID 57215
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-THAP11 Antibody 25ul

Anti-THAP11 Antibody 25ul