RNF40,BRE1B
  • RNF40,BRE1B

Anti-RNF40 Antibody 25ul

Ref: AN-HPA041330-25ul
Anti-RNF40

Información del producto

Polyclonal Antibody against Human RNF40, Gene description: ring finger protein 40, E3 ubiquitin protein ligase, Alternative Gene Names: BRE1B, KIAA0661, RBP95, STARING, Validated applications: IHC, WB, Uniprot ID: O75150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF40
Gene Description ring finger protein 40, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
Immunogen AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRE1B, KIAA0661, RBP95, STARING
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75150
HTS Code 3002150000
Gene ID 9810
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RNF40 Antibody 25ul

Anti-RNF40 Antibody 25ul