ZC3H18,NHN1
  • ZC3H18,NHN1

Anti-ZC3H18 Antibody 100ul

Ref: AN-HPA041327-100ul
Anti-ZC3H18

Información del producto

Polyclonal Antibody against Human ZC3H18, Gene description: zinc finger CCCH-type containing 18, Alternative Gene Names: NHN1, Validated applications: ICC, IHC, Uniprot ID: Q86VM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZC3H18
Gene Description zinc finger CCCH-type containing 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Immunogen QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NHN1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VM9
HTS Code 3002150000
Gene ID 124245
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZC3H18 Antibody 100ul

Anti-ZC3H18 Antibody 100ul