TXNL4A,DIB1,DIM1
  • TXNL4A,DIB1,DIM1

Anti-TXNL4A Antibody 25ul

Ref: AN-HPA041324-25ul
Anti-TXNL4A

Información del producto

Polyclonal Antibody against Human TXNL4A, Gene description: thioredoxin-like 4A, Alternative Gene Names: DIB1, DIM1, HsT161, SNRNP15, TXNL4, U5-15kD, Validated applications: ICC, Uniprot ID: P83876, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TXNL4A
Gene Description thioredoxin-like 4A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK
Immunogen MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DIB1, DIM1, HsT161, SNRNP15, TXNL4, U5-15kD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P83876
HTS Code 3002150000
Gene ID 10907
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TXNL4A Antibody 25ul

Anti-TXNL4A Antibody 25ul