KBTBD8,KIAA1842
  • KBTBD8,KIAA1842

Anti-KBTBD8 Antibody 100ul

Ref: AN-HPA041285-100ul
Anti-KBTBD8

Información del producto

Polyclonal Antibody against Human KBTBD8, Gene description: kelch repeat and BTB (POZ) domain containing 8, Alternative Gene Names: KIAA1842, TA-KRP, Validated applications: IHC, WB, Uniprot ID: Q8NFY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KBTBD8
Gene Description kelch repeat and BTB (POZ) domain containing 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV
Immunogen IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1842, TA-KRP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFY9
HTS Code 3002150000
Gene ID 84541
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KBTBD8 Antibody 100ul

Anti-KBTBD8 Antibody 100ul