EIF2S2,EIF2
  • EIF2S2,EIF2

Anti-EIF2S2 Antibody 25ul

Ref: AN-HPA041262-25ul
Anti-EIF2S2

Información del producto

Polyclonal Antibody against Human EIF2S2, Gene description: eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa, Alternative Gene Names: EIF2, EIF2beta, PPP1R67, Validated applications: ICC, Uniprot ID: P20042, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF2S2
Gene Description eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDED
Immunogen KIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF2, EIF2beta, PPP1R67
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20042
HTS Code 3002150000
Gene ID 8894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EIF2S2 Antibody 25ul

Anti-EIF2S2 Antibody 25ul