CNTN5,hNB-2,NB-2
  • CNTN5,hNB-2,NB-2

Anti-CNTN5 Antibody 25ul

Ref: AN-HPA041223-25ul
Anti-CNTN5

Información del producto

Polyclonal Antibody against Human CNTN5, Gene description: contactin 5, Alternative Gene Names: hNB-2, NB-2, Validated applications: ICC, IHC, Uniprot ID: O94779, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CNTN5
Gene Description contactin 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Immunogen IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hNB-2, NB-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94779
HTS Code 3002150000
Gene ID 53942
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CNTN5 Antibody 25ul

Anti-CNTN5 Antibody 25ul