C16orf70,C16orf6
  • C16orf70,C16orf6

Anti-C16orf70 Antibody 100ul

Ref: AN-HPA041214-100ul
Anti-C16orf70

Información del producto

Polyclonal Antibody against Human C16orf70, Gene description: chromosome 16 open reading frame 70, Alternative Gene Names: C16orf6, FLJ12076, lin-10, LIN10, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BSU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C16orf70
Gene Description chromosome 16 open reading frame 70
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKL
Immunogen MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf6, FLJ12076, lin-10, LIN10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSU1
HTS Code 3002150000
Gene ID 80262
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C16orf70 Antibody 100ul

Anti-C16orf70 Antibody 100ul