NAE1,APPBP1,ula-1
  • NAE1,APPBP1,ula-1

Anti-NAE1 Antibody 25ul

Ref: AN-HPA041178-25ul
Anti-NAE1

Información del producto

Polyclonal Antibody against Human NAE1, Gene description: NEDD8 activating enzyme E1 subunit 1, Alternative Gene Names: APPBP1, ula-1, Validated applications: IHC, WB, Uniprot ID: Q13564, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NAE1
Gene Description NEDD8 activating enzyme E1 subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
Immunogen PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APPBP1, ula-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13564
HTS Code 3002150000
Gene ID 8883
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NAE1 Antibody 25ul

Anti-NAE1 Antibody 25ul