FAAP24,C19orf40
  • FAAP24,C19orf40

Anti-FAAP24 Antibody 100ul

Ref: AN-HPA041168-100ul
Anti-FAAP24

Información del producto

Polyclonal Antibody against Human FAAP24, Gene description: Fanconi anemia core complex associated protein 24, Alternative Gene Names: C19orf40, FLJ46828, MGC32020, Validated applications: ICC, IHC, Uniprot ID: Q9BTP7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAAP24
Gene Description Fanconi anemia core complex associated protein 24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
Immunogen VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf40, FLJ46828, MGC32020
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTP7
HTS Code 3002150000
Gene ID 91442
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAAP24 Antibody 100ul

Anti-FAAP24 Antibody 100ul