DOK6,DOK5L,HsT3226
  • DOK6,DOK5L,HsT3226

Anti-DOK6 Antibody 100ul

Ref: AN-HPA041099-100ul
Anti-DOK6

Información del producto

Polyclonal Antibody against Human DOK6, Gene description: docking protein 6, Alternative Gene Names: DOK5L, HsT3226, MGC20785, Validated applications: IHC, Uniprot ID: Q6PKX4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DOK6
Gene Description docking protein 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Immunogen WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DOK5L, HsT3226, MGC20785
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PKX4
HTS Code 3002150000
Gene ID 220164
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DOK6 Antibody 100ul

Anti-DOK6 Antibody 100ul