KNOP1,101F10.1
  • KNOP1,101F10.1

Anti-KNOP1 Antibody 100ul

Ref: AN-HPA041079-100ul
Anti-KNOP1

Información del producto

Polyclonal Antibody against Human KNOP1, Gene description: lysine-rich nucleolar protein 1, Alternative Gene Names: 101F10.1, C16orf88, FAM191A, TSG118, Validated applications: ICC, IHC, WB, Uniprot ID: Q1ED39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KNOP1
Gene Description lysine-rich nucleolar protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKL
Immunogen TAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 101F10.1, C16orf88, FAM191A, TSG118
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q1ED39
HTS Code 3002150000
Gene ID 400506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KNOP1 Antibody 100ul

Anti-KNOP1 Antibody 100ul