KIF22,Kid,KNSL4
  • KIF22,Kid,KNSL4

Anti-KIF22 Antibody 25ul

Ref: AN-HPA041076-25ul
Anti-KIF22

Información del producto

Polyclonal Antibody against Human KIF22, Gene description: kinesin family member 22, Alternative Gene Names: Kid, KNSL4, OBP-1, OBP-2, Validated applications: IHC, WB, Uniprot ID: Q14807, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KIF22
Gene Description kinesin family member 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG
Immunogen SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Kid, KNSL4, OBP-1, OBP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14807
HTS Code 3002150000
Gene ID 3835
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KIF22 Antibody 25ul

Anti-KIF22 Antibody 25ul