ZC3H4,C19orf7
  • ZC3H4,C19orf7

Anti-ZC3H4 Antibody 100ul

Ref: AN-HPA041068-100ul
Anti-ZC3H4

Información del producto

Polyclonal Antibody against Human ZC3H4, Gene description: zinc finger CCCH-type containing 4, Alternative Gene Names: C19orf7, KIAA1064, Validated applications: ICC, IHC, Uniprot ID: Q9UPT8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZC3H4
Gene Description zinc finger CCCH-type containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPKKAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFT
Immunogen FSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPKKAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf7, KIAA1064
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPT8
HTS Code 3002150000
Gene ID 23211
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZC3H4 Antibody 100ul

Anti-ZC3H4 Antibody 100ul