RMI2,BLAP18
  • RMI2,BLAP18

Anti-RMI2 Antibody 25ul

Ref: AN-HPA040995-25ul
Anti-RMI2

Información del producto

Polyclonal Antibody against Human RMI2, Gene description: RecQ mediated genome instability 2, Alternative Gene Names: BLAP18, C16orf75, MGC24665, Validated applications: ICC, IHC, Uniprot ID: Q96E14, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RMI2
Gene Description RecQ mediated genome instability 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Immunogen GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BLAP18, C16orf75, MGC24665
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96E14
HTS Code 3002150000
Gene ID 116028
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RMI2 Antibody 25ul

Anti-RMI2 Antibody 25ul