DNAJA3,hTid-1,TID1
  • DNAJA3,hTid-1,TID1

Anti-DNAJA3 Antibody 25ul

Ref: AN-HPA040875-25ul
Anti-DNAJA3

Información del producto

Polyclonal Antibody against Human DNAJA3, Gene description: DnaJ (Hsp40) homolog, subfamily A, member 3, Alternative Gene Names: hTid-1, TID1, Validated applications: ICC, IHC, Uniprot ID: Q96EY1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAJA3
Gene Description DnaJ (Hsp40) homolog, subfamily A, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST
Immunogen DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hTid-1, TID1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EY1
HTS Code 3002150000
Gene ID 9093
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAJA3 Antibody 25ul

Anti-DNAJA3 Antibody 25ul