C1orf68,LEP7
  • C1orf68,LEP7

Anti-C1orf68 Antibody 100ul

Ref: AN-HPA040836-100ul
Anti-C1orf68

Información del producto

Polyclonal Antibody against Human C1orf68, Gene description: chromosome 1 open reading frame 68, Alternative Gene Names: LEP7, Validated applications: IHC, Uniprot ID: Q5T750, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1orf68
Gene Description chromosome 1 open reading frame 68
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG
Immunogen PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LEP7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T750
HTS Code 3002150000
Gene ID 100129271
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf68 Antibody 100ul

Anti-C1orf68 Antibody 100ul