FSTL1,FRP,FSL1
  • FSTL1,FRP,FSL1

Anti-FSTL1 Antibody 25ul

Ref: AN-HPA040815-25ul
Anti-FSTL1

Información del producto

Polyclonal Antibody against Human FSTL1, Gene description: follistatin like 1, Alternative Gene Names: FRP, FSL1, OCC-1, OCC1, tsc36, Validated applications: IHC, Uniprot ID: Q12841, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FSTL1
Gene Description follistatin like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK
Immunogen KCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FRP, FSL1, OCC-1, OCC1, tsc36
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12841
HTS Code 3002150000
Gene ID 11167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FSTL1 Antibody 25ul

Anti-FSTL1 Antibody 25ul