CISH,CIS,CIS-1,G18
  • CISH,CIS,CIS-1,G18

Anti-CISH Antibody 25ul

Ref: AN-HPA040812-25ul
Anti-CISH

Información del producto

Polyclonal Antibody against Human CISH, Gene description: cytokine inducible SH2-containing protein, Alternative Gene Names: CIS, CIS-1, G18, SOCS, Validated applications: ICC, IHC, Uniprot ID: Q9NSE2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CISH
Gene Description cytokine inducible SH2-containing protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR
Immunogen APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIS, CIS-1, G18, SOCS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NSE2
HTS Code 3002150000
Gene ID 1154
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CISH Antibody 25ul

Anti-CISH Antibody 25ul