DLAT,DLTA,PDC-E2
  • DLAT,DLTA,PDC-E2

Anti-DLAT Antibody 100ul

Ref: AN-HPA040786-100ul
Anti-DLAT

Información del producto

Polyclonal Antibody against Human DLAT, Gene description: dihydrolipoamide S-acetyltransferase, Alternative Gene Names: DLTA, PDC-E2, Validated applications: ICC, IHC, WB, Uniprot ID: P10515, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DLAT
Gene Description dihydrolipoamide S-acetyltransferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT
Immunogen LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DLTA, PDC-E2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P10515
HTS Code 3002150000
Gene ID 1737
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DLAT Antibody 100ul

Anti-DLAT Antibody 100ul