PCF11,KIAA0824
  • PCF11,KIAA0824

Anti-PCF11 Antibody 25ul

Ref: AN-HPA040779-25ul
Anti-PCF11

Información del producto

Polyclonal Antibody against Human PCF11, Gene description: PCF11 cleavage and polyadenylation factor subunit, Alternative Gene Names: KIAA0824, Validated applications: ICC, Uniprot ID: O94913, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCF11
Gene Description PCF11 cleavage and polyadenylation factor subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAG
Immunogen GIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0824
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94913
HTS Code 3002150000
Gene ID 51585
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCF11 Antibody 25ul

Anti-PCF11 Antibody 25ul