RCCD1,MGC14386
  • RCCD1,MGC14386

Anti-RCCD1 Antibody 25ul

Ref: AN-HPA040776-25ul
Anti-RCCD1

Información del producto

Polyclonal Antibody against Human RCCD1, Gene description: RCC1 domain containing 1, Alternative Gene Names: MGC14386, Validated applications: ICC, IHC, WB, Uniprot ID: A6NED2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RCCD1
Gene Description RCC1 domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
Immunogen PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC14386
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NED2
HTS Code 3002150000
Gene ID 91433
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RCCD1 Antibody 25ul

Anti-RCCD1 Antibody 25ul