ANKDD1A,FLJ25870
  • ANKDD1A,FLJ25870

Anti-ANKDD1A Antibody 25ul

Ref: AN-HPA040757-25ul
Anti-ANKDD1A

Información del producto

Polyclonal Antibody against Human ANKDD1A, Gene description: ankyrin repeat and death domain containing 1A, Alternative Gene Names: FLJ25870, Validated applications: ICC, IHC, Uniprot ID: Q495B1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANKDD1A
Gene Description ankyrin repeat and death domain containing 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV
Immunogen LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25870
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q495B1
HTS Code 3002150000
Gene ID 348094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKDD1A Antibody 25ul

Anti-ANKDD1A Antibody 25ul