BFSP1,CP115,CP94
  • BFSP1,CP115,CP94

Anti-BFSP1 Antibody 25ul

Ref: AN-HPA040748-25ul
Anti-BFSP1

Información del producto

Polyclonal Antibody against Human BFSP1, Gene description: beaded filament structural protein 1, filensin, Alternative Gene Names: CP115, CP94, filensin, LIFL-H, Validated applications: ICC, IHC, Uniprot ID: Q12934, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BFSP1
Gene Description beaded filament structural protein 1, filensin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD
Immunogen SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CP115, CP94, filensin, LIFL-H
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12934
HTS Code 3002150000
Gene ID 631
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BFSP1 Antibody 25ul

Anti-BFSP1 Antibody 25ul