ANKRD12,FLJ20053
  • ANKRD12,FLJ20053

Anti-ANKRD12 Antibody 25ul

Ref: AN-HPA040705-25ul
Anti-ANKRD12

Información del producto

Polyclonal Antibody against Human ANKRD12, Gene description: ankyrin repeat domain 12, Alternative Gene Names: FLJ20053, GAC-1, KIAA0874, Validated applications: ICC, IHC, Uniprot ID: Q6UB98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANKRD12
Gene Description ankyrin repeat domain 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSRVLYSSTESSDEEALQNKKISTSCSVIPETSNSDMQTKKEYVVSGEHKQKGKVKRKLK
Immunogen MIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSRVLYSSTESSDEEALQNKKISTSCSVIPETSNSDMQTKKEYVVSGEHKQKGKVKRKLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20053, GAC-1, KIAA0874
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UB98
HTS Code 3002150000
Gene ID 23253
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKRD12 Antibody 25ul

Anti-ANKRD12 Antibody 25ul