SLC8B1,FLJ22233
  • SLC8B1,FLJ22233

Anti-SLC8B1 Antibody 100ul

Ref: AN-HPA040668-100ul
Anti-SLC8B1

Información del producto

Polyclonal Antibody against Human SLC8B1, Gene description: solute carrier family 8 (sodium/lithium/calcium exchanger), member B1, Alternative Gene Names: FLJ22233, NCKX6, NCLX, SLC24A6, Validated applications: IHC, Uniprot ID: Q6J4K2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC8B1
Gene Description solute carrier family 8 (sodium/lithium/calcium exchanger), member B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
Immunogen RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22233, NCKX6, NCLX, SLC24A6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6J4K2
HTS Code 3002150000
Gene ID 80024
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC8B1 Antibody 100ul

Anti-SLC8B1 Antibody 100ul