WDFY4,C10orf64
  • WDFY4,C10orf64

Anti-WDFY4 Antibody 25ul

Ref: AN-HPA040634-25ul
Anti-WDFY4

Información del producto

Polyclonal Antibody against Human WDFY4, Gene description: WDFY family member 4, Alternative Gene Names: C10orf64, Em:AC060234.3, FLJ45748, KIAA1607, Validated applications: ICC, IHC, Uniprot ID: Q6ZS81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDFY4
Gene Description WDFY family member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
Immunogen VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf64, Em:AC060234.3, FLJ45748, KIAA1607
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZS81
HTS Code 3002150000
Gene ID 57705
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDFY4 Antibody 25ul

Anti-WDFY4 Antibody 25ul