SNRPD1,HsT2456
  • SNRPD1,HsT2456

Anti-SNRPD1 Antibody 25ul

Ref: AN-HPA040516-25ul
Anti-SNRPD1

Información del producto

Polyclonal Antibody against Human SNRPD1, Gene description: small nuclear ribonucleoprotein D1 polypeptide 16kDa, Alternative Gene Names: HsT2456, Sm-D1, SNRPD, Validated applications: IHC, WB, Uniprot ID: P62314, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNRPD1
Gene Description small nuclear ribonucleoprotein D1 polypeptide 16kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Immunogen SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT2456, Sm-D1, SNRPD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62314
HTS Code 3002150000
Gene ID 6632
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNRPD1 Antibody 25ul

Anti-SNRPD1 Antibody 25ul