FERMT2,KIND2,mig-2
  • FERMT2,KIND2,mig-2

Anti-FERMT2 Antibody 100ul

Ref: AN-HPA040505-100ul
Anti-FERMT2

Información del producto

Polyclonal Antibody against Human FERMT2, Gene description: fermitin family member 2, Alternative Gene Names: KIND2, mig-2, PLEKHC1, UNC112B, Validated applications: ICC, IHC, WB, Uniprot ID: Q96AC1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FERMT2
Gene Description fermitin family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA
Immunogen MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIND2, mig-2, PLEKHC1, UNC112B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96AC1
HTS Code 3002150000
Gene ID 10979
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FERMT2 Antibody 100ul

Anti-FERMT2 Antibody 100ul