ATG3,APG3L
  • ATG3,APG3L

Anti-ATG3 Antibody 100ul

Ref: AN-HPA040471-100ul
Anti-ATG3

Información del producto

Polyclonal Antibody against Human ATG3, Gene description: autophagy related 3, Alternative Gene Names: APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, Validated applications: IHC, Uniprot ID: Q9NT62, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATG3
Gene Description autophagy related 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCE
Immunogen KGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NT62
HTS Code 3002150000
Gene ID 64422
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ATG3 Antibody 100ul

Anti-ATG3 Antibody 100ul